All Photos(4)

Key Documents

SAB1402159

Monoclonal Anti-CSF2RA antibody produced in mouse

Name: Monoclonal Anti-CSF2RA antibody produced in mouse
Brand: SIGMA

clone 2G5, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

All Photos(4)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G5, monoclonal

form

buffered aqueous solution

mol wt

antigen ~70.11 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	MAB1789	ABN59	MABF291
ABF125 Anti-S100A8/MRP-8 Antibody (Azide Free)	MAB1789 Anti-Migration Inhibitory Factor Related Proteins 8 and 14 Antibody, clone AHN-17	ABN59 Anti-S100B Antibody	MABF291 Anti-S100A8/S100A9 Antibody, clone 5.5
biological source rabbit	biological source mouse	biological source rabbit	biological source mouse
antibody form serum	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form purified immunoglobulin
Quality Level 100	Quality Level 100	Quality Level 100, 300	Quality Level 100
UniProt accession no. P27005	UniProt accession no. P05109	UniProt accession no. P04271	UniProt accession no. P05109, P06702
Gene Information human ... S100A8(6279)	Gene Information human ... S100A8(6279)	Gene Information rat ... S100B(25742)	Gene Information human ... S100A8(6279), S100A9(6280)
technique(s) activity assay: suitable, western blot: suitable, immunohistochemistry: suitable	technique(s) immunocytochemistry: suitable, western blot: suitable	technique(s) immunohistochemistry: suitable (paraffin), western blot: suitable	technique(s) ELISA: suitable, flow cytometry: suitable, immunohistochemistry: suitable, immunoprecipitation (IP): suitable, western blot: suitable

General description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. (provided by RefSeq)

Immunogen

CSF2RA (AAH02635.1, 1 a.a. ~ 400 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08228-2G5

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service