All Photos(3)

Key Documents

SAB1402479

Monoclonal Anti-WTAP, (C-terminal) antibody produced in mouse

Name: Monoclonal Anti-WTAP, (C-terminal) antibody produced in mouse
Brand: SIGMA

clone 1B11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

DKFZp686F20131, KIAA0105, MGC3925

Sign Into View Organizational & Contract Pricing

All Photos(3)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B11, monoclonal

form

buffered aqueous solution

mol wt

antigen ~35.13 kDa

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA043737	MABS1166	SAB1401676
SAB1411435 Anti-ADIPOR2 antibody produced in rabbit	HPA043737 Anti-ADIPOR2 antibody produced in rabbit	MABS1166 Anti-AdipoR2 Antibody, clone 4D3.2	SAB1401676 Monoclonal Anti-ADIPOR1 antibody produced in mouse
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source mouse	biological source mouse
antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form purified immunoglobulin
conjugate unconjugated	conjugate unconjugated	conjugate -	conjugate unconjugated
technique(s) western blot: 1 μg/mL	technique(s) immunohistochemistry: 1:50-1:200	technique(s) immunohistochemistry: suitable (paraffin), western blot: suitable	technique(s) capture ELISA: suitable
shipped in dry ice	shipped in wet ice	shipped in wet ice	shipped in dry ice

General description

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. (provided by RefSeq)

Immunogen

WTAP (NP_690596.1, 70 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08186-1B11

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Self-limiting growth of metal fluoride thin films by oxidation reactions employing molecular precursors

Qiu et al.

Physical review letters, 85(7), 1492-1495 (2000-09-06)

FeF (2) films are grown by the reaction of XeF (2) and SeF (6) with iron foil. The growth initially follows the Mott-Cabrera parabolic rate law, indicating that the process is diffusion limited. At a certain film thickness, however, the

Fabrication of zero valent iron (ZVI) nanotube film via potentiostatic anodization and electroreduction.

Jun-Won Jang et al.

Water science and technology : a journal of the International Association on Water Pollution Research, 59(12), 2503-2507 (2009-06-23)

Zero valent iron has been successfully used for the degradation of a wide range of contaminants. However, this reaction of using ZVI particle produces a large quantity of iron sludge. To solve the problem, we report the synthesis of self-organized

The role of reduced iron powder in the fermentative production of tetanus toxin.

Arnold L Demain et al.

Applied microbiology and biotechnology, 73(1), 55-59 (2006-04-20)

When tetanus toxin is made by fermentation with Clostridium tetani, the traditional source of iron is an insoluble preparation called reduced iron powder. This material removes oxygen from the system by forming FeO(2) (rust). When inoculated in a newly developed

Aerobactin mediates virulence and accounts for increased siderophore production under iron-limiting conditions by hypervirulent (hypermucoviscous) Klebsiella pneumoniae.

Thomas A Russo et al.

Infection and immunity, 82(6), 2356-2367 (2014-03-26)

Hypervirulent (hypermucoviscous) Klebsiella pneumoniae (hvKP) strains are an emerging variant of "classical" K. pneumoniae (cKP) that cause organ and life-threatening infection in healthy individuals. An understanding of hvKP-specific virulence mechanisms that enabled evolution from cKP is limited. Observations by our

Crystal structure of PhnZ in complex with substrate reveals a di-iron oxygenase mechanism for catabolism of organophosphonates.

Laura M van Staalduinen et al.

Proceedings of the National Academy of Sciences of the United States of America, 111(14), 5171-5176 (2014-04-08)

The enzymes PhnY and PhnZ comprise an oxidative catabolic pathway that enables marine bacteria to use 2-aminoethylphosphonic acid as a source of inorganic phosphate. PhnZ is notable for catalyzing the oxidative cleavage of a carbon-phosphorus bond using Fe(II) and dioxygen

View All Related Papers

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service