SAB1403689

Monoclonal Anti-CLDN4 antibody produced in mouse

clone 4A11, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4A11, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~31.61 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable
• isotype: IgG3κ
• NCBI accession no.: NM_001305
• UniProt accession no.: O14493
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CLDN4(1364)

Description

General description

This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. (provided by RefSeq)

Immunogen

CLDN4 (NP_001296, 29 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable