SAB1404658

Monoclonal Anti-SOCS3 antibody produced in mouse

clone 2E5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~50.86 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: BC060858
• UniProt accession no.: O14543
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SOCS3(9021)

Description

General description

Suppressor of cytokine signaling 3 (SOCS3) is encoded by the gene mapped to human chromosome 17q25.3.The encoded protein belongs to the SOCS protein family.

Immunogen

SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Biochem/physiol Actions

Suppressor of cytokine signaling 3 (SOCS3) plays a vital role in cytokine signaling. The encoded protein has an ability to bind and inhibit janus kinases (JAKs), turning off signal transducers and activators of transcription 3 (STAT3) signaling in response to interferon (IFN)-6 stimulation. Downregulated expression of the gene enhance the growth and metastasis of colorectal cancer (CRC). Thus, targeting IL-6/STAT3/SOCS3 signaling pathway can be considered as a potent therapeutic strategy for CRC.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable