All Photos(2)

Key Documents

SAB1404744

Monoclonal Anti-ABCG1 antibody produced in mouse

Name: Monoclonal Anti-ABCG1 antibody produced in mouse
Brand: SIGMA

clone 2H8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

ABC8, MGC34313, WHITE1

Sign Into View Organizational & Contract Pricing

All Photos(2)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H8, monoclonal

form

buffered aqueous solution

mol wt

antigen ~38.1 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	ZRB1341	ZRB1351	ZRB1002
ZRB1330 Anti-N1-Phosphohistidine (1-pHis) Antibody, clone SC1-1, ZooMAb^® Rabbit Monoclonal	ZRB1341 Anti-N1-Phosphohistidine (1-pHis) Antibody, clone SC50-3, ZooMAb^® Rabbit Monoclonal	ZRB1351 Anti-N3-Phosphohistidine (3-pHis) Antibody, clone SC39-6, ZooMAb^® Rabbit Monoclonal	ZRB1002 Anti-HMGB1 Antibody, clone 3K6, ZooMAb^® Rabbit Monoclonal
clone SC1-1, monoclonal, recombinant monoclonal	clone SC50-3, monoclonal, recombinant monoclonal	clone SC39-6, monoclonal, recombinant monoclonal	clone 3K6, recombinant monoclonal
antibody form purified antibody	antibody form purified antibody	antibody form purified antibody	antibody form purified antibody
biological source rabbit (recombinant)	biological source rabbit (recombinant)	biological source rabbit (recombinant)	biological source rabbit (recombinant)
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
species reactivity human	species reactivity human	species reactivity human	species reactivity mouse, human
technique(s) western blot: suitable using 1:1,000	technique(s) western blot: suitable using 1:1,000	technique(s) western blot: suitable using 1:1,000	technique(s) immunocytochemistry: suitable using 1:100, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100, western blot: suitable using 1:1,000

General description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. (provided by RefSeq)

Immunogen

ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08319-2H8

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service