All Photos(1)

Key Documents

SAB1407414

Anti-CD207 antibody produced in mouse

Name: Anti-CD207 antibody produced in mouse
Brand: SIGMA

purified immunoglobulin, buffered aqueous solution

Synonym(s):

CLEC4K

Sign Into View Organizational & Contract Pricing

All Photos(1)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~36.19 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	EP022628124	EP022628001	EP022626001
EP022628102 Eppendorf^® Centrifuge 5702/5702R/5702RH	EP022628124 Eppendorf^® Centrifuge 5702/5702R/5702RH	EP022628001 Eppendorf^® Centrifuge 5702/5702R/5702RH	EP022626001 Eppendorf^® Centrifuge 5702/5702R/5702RH
feature CSA approved, to hold 4 50 ml conical tubes, non-refrigerated, to hold 4 100 mL round buckets, rotary knobs, to hold 8 15 mL conical tubes	feature CSA approved, to hold 4 100 mL round buckets, to hold 4 50 ml conical tubes, to hold 8 15 mL conical tubes, refrigerated/heated, rotary knobs	feature CSA approved, to hold 16 13/16 mm blood collection tubes, to hold 4 100 mL round buckets, non-refrigerated, rotary knobs	feature CSA approved, non-refrigerated, rotary knobs
parameter 100-4,400 rpm speed, 3,000 × g max. RCF	parameter -9-40 °C temp. range, 100-4,400 rpm speed, 3,000 × g max. RCF	parameter 100-4,400 rpm speed, 3,000 × g max. RCF	parameter 100-4,400 rpm speed, 3,000 × g max. RCF
manufacturer/tradename Eppendorf^® 022628102 (NA)	manufacturer/tradename Eppendorf^® 022628124 (NA)	manufacturer/tradename Eppendorf^® 022628001 (NA)	manufacturer/tradename Eppendorf^® 022626001 (NA)
technique(s) centrifugation: suitable	technique(s) centrifugation: suitable	technique(s) centrifugation: suitable	technique(s) centrifugation: suitable
W × H × D 32 cm × 40 cm × 24 cm	W × H × D 38 cm × 58 cm × 26 cm	W × H × D 32 cm × 40 cm × 24 cm	W × H × D 32 cm × 40 cm × 24 cm
weight 20 kg	weight 36 kg	weight 20 kg	weight 20 kg

General description

The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. (provided by RefSeq)

Immunogen

CD207 (AAH22278, 1 a.a. ~ 328 a.a) full-length human protein.

Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08352

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service