All Photos(2)

Key Documents

SAB1409245

Monoclonal Anti-IL8 antibody produced in mouse

Name: Monoclonal Anti-IL8 antibody produced in mouse
Brand: SIGMA

clone 1A3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF

Sign Into View Organizational & Contract Pricing

All Photos(2)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1A3, monoclonal

form

buffered aqueous solution

mol wt

antigen 8.69 kDa

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	15136	73124	92427
90865 3-Iodo-2-propynyl N-butylcarbamate	15136 Bisphenol A bis(3-chloro-2-hydroxypropyl) ether	73124 Bisphenol A (3-chloro-2-hydroxypropyl) glycidyl ether	92427 Bisphenol A (3-chloro-2-hydroxypropyl) (2,3-dihydroxypropyl) ether
grade analytical standard	grade analytical standard	grade analytical standard	grade analytical standard
technique(s) HPLC: suitable, gas chromatography (GC): suitable	technique(s) HPLC: suitable, gas chromatography (GC): suitable	technique(s) HPLC: suitable, gas chromatography (GC): suitable	technique(s) HPLC: suitable, gas chromatography (GC): suitable
application(s) cleaning products cosmetics food and beverages personal care	application(s) cleaning products cosmetics food and beverages personal care	application(s) cleaning products cosmetics food and beverages personal care	application(s) cleaning products cosmetics food and beverages personal care
format neat	format neat	format neat	format neat
assay ≥98.5% (GC)	assay ≥97.0% (HPLC)	assay ≥90% (HPLC)	assay ≥95.0% (HPLC)
shelf life limited shelf life, expiry date on the label	shelf life -	shelf life limited shelf life, expiry date on the label	shelf life -

General description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)

Immunogen

IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Biochem/physiol Actions

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08008-1A3

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Label-free electrochemical impedance biosensor to detect human interleukin-8 in serum with sub-pg/ml sensitivity.

Sharma R

Biosensors And Bioelectronics, 80, 607-613 (2016)

Solution NMR characterization of chemokine CXCL8/IL-8 monomer and dimer binding to glycosaminoglycans: structural plasticity mediates differential binding interactions.

Prem Raj B Joseph et al.

The Biochemical journal, 472(1), 121-133 (2015-09-16)

Chemokine CXCL8/interleukin-8 (IL-8) plays a crucial role in directing neutrophils and oligodendrocytes to combat infection/injury and tumour cells in metastasis development. CXCL8 exists as monomers and dimers and interaction of both forms with glycosaminoglycans (GAGs) mediate these diverse cellular processes.

The chemokine and chemokine receptor superfamilies and their molecular evolution.

Zlotnik A

Genome Biology, 7(12), 243-243 (2006)

Interleukin-8 is a prognostic indicator in human hilar cholangiocarcinoma.

Qi Sun et al.

International journal of clinical and experimental pathology, 8(7), 8376-8384 (2015-09-05)

Interleukin-8 (IL-8), matrix metalloproteinase-9 (MMP-9) and neovascularization have been implicated to be associated with biological processes, especially cancer progression. However, few studies have investigated the role of IL-8 in human hilar cholangiocarcinoma. In this study we detected the expression of

Robust and selective nano cavities for protein separation: an interpenetrating polymer network modified hierarchically protein imprinted hydrogel.

Ali Nematollahzadeh et al.

Journal of chromatography. A, 1345, 154-163 (2014-05-03)

In the present work, we report a novel method for the reinforcement of hierarchically structured molecularly imprinted polymer (MIP) for the separation of human serum albumin (HSA) and immunoglobulin G (IgG) proteins under pressure driven flow conditions. The template proteins

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service