All Photos(1)

Key Documents

SAB1409339

Monoclonal Anti-MYOG antibody produced in mouse

Name: Monoclonal Anti-MYOG antibody produced in mouse
Brand: SIGMA

clone 3E3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

MYF4, MYOGENIN, bHLHc3

Sign Into View Organizational & Contract Pricing

All Photos(1)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E3, monoclonal

form

buffered aqueous solution

mol wt

antigen 50.38 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	SAB1410814	M5815	SAB1404105
SAB1409339 Monoclonal Anti-MYOG antibody produced in mouse	SAB1410814 Anti-MYOG antibody produced in rabbit	M5815 Monoclonal Anti-Myogenin antibody produced in mouse	SAB1404105 Monoclonal Anti-MYOC antibody produced in mouse
clone 3E3, monoclonal	clone polyclonal	clone F12B, monoclonal	clone 2B4, monoclonal
biological source mouse	biological source rabbit	biological source mouse	biological source mouse
Gene Information human ... MYOG(4656)	Gene Information human ... MYOG(4656)	Gene Information human ... MYOG(4656) mouse ... Myog(17928) rat ... Myog(29148)	Gene Information human ... MYOC(4653)
antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form purified immunoglobulin
species reactivity human	species reactivity human, mouse	species reactivity mouse, rat, human	species reactivity human
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated

General description

Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. (provided by RefSeq)

Immunogen

MYOG (AAH53899, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

07215-3E3

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Uniaxial cyclic strain enhances adipose-derived stem cell fusion with skeletal myocytes.

Jens Isak Andersen et al.

Biochemical and biophysical research communications, 450(2), 1083-1088 (2014-07-06)

Although adult muscle tissue possesses an exceptional capacity for regeneration, in the case of large defects, the restoration to original state is not possible. A well-known source for the de novo regeneration is the adipose-derived stem cells (ASCs), which can

Myogenesis defect due to Toca-1 knockdown can be suppressed by expression of N-WASP.

Bhawana George et al.

Biochimica et biophysica acta, 1843(9), 1930-1941 (2014-05-28)

Skeletal muscle formation is a multistep process involving proliferation, differentiation, alignment and fusion of myoblasts to form myotubes which fuse with additional myoblast to form myofibers. Toca-1 (Transducer of Cdc42-dependent actin assembly), is an adaptor protein which activates N-WASP in

Notch signaling deficiency underlies age-dependent depletion of satellite cells in muscular dystrophy.

Chunhui Jiang et al.

Disease models & mechanisms, 7(8), 997-1004 (2014-06-08)

Duchenne muscular dystrophy (DMD) is a devastating disease characterized by muscle wasting, loss of mobility and death in early adulthood. Satellite cells are muscle-resident stem cells responsible for the repair and regeneration of damaged muscles. One pathological feature of DMD

Myogenin gene expression is not altered in the developing diaphragm of nitrofen-induced congenital diaphragmatic hernia.

Toshiaki Takahashi et al.

Pediatric surgery international, 30(9), 901-906 (2014-07-25)

Pleuroperitoneal folds (PPFs) represent the only source of muscle precursors cells (MPCs) in the primordial diaphragm. However, the exact pathogenesis of malformed PPFs and congenital diaphragmatic hernia (CDH) remains unclear. The muscle-specific transcription factor myogenin plays a key role during

Substrate stress relaxation regulates cell spreading.

Ovijit Chaudhuri et al.

Nature communications, 6, 6364-6364 (2015-02-20)

Studies of cellular mechanotransduction have converged upon the idea that cells sense extracellular matrix (ECM) elasticity by gauging resistance to the traction forces they exert on the ECM. However, these studies typically utilize purely elastic materials as substrates, whereas physiological

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service