SAB1409873

Monoclonal Anti-SETDB2 antibody produced in mouse

clone 1H3, ascites fluid, solution

• Synonym(s): C13orf4, CLLD8, CLLL8, DKFZp586I0123, DKFZp761J1217, KMT1F
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1H3, monoclonal
• form: solution
• mol wt: antigen 36.74 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_031915
• UniProt accession no.: Q96T68
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SETDB2(83852)

Description

General description

Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 (see MIM 601128) methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity (Zhang et al., 2003 [PubMed 12754510]).[supplied by OMIM

Immunogen

SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL

Physical form

Clear solution

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable