All Photos(3)

Key Documents

SAB1411587

Anti-CCND2 antibody produced in rabbit

Name: Anti-CCND2 antibody produced in rabbit
Brand: SIGMA

purified immunoglobulin, buffered aqueous solution

Synonym(s):

KIAK0002, MGC102758

Sign Into View Organizational & Contract Pricing

All Photos(3)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen 33.1 kDa

species reactivity

human

technique(s)

immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	Z740502	Z740501	Z742385
Z680362 Eco-friendly glassine weighing boat	Z740502 smartBoat^™ disposable paper weighing boats	Z740501 smartBoat^™ disposable paper weighing boats	Z742385 smartBoat^™ disposable paper weighing boats
material circles , glassine paper	material paper , white	material paper , white	material paper , white
manufacturer/tradename Diversified Biotech BOAT-2000	manufacturer/tradename LevGo Inc 20302	manufacturer/tradename LevGo Inc 20301	manufacturer/tradename LevGo Inc 20303
packaging pack of 150 ea (Internal packs of 150), case of 3600 ea	packaging pack of 500 ea	packaging pack of 500 ea	packaging case of 2000 ea (Internal packs of 250), pack of 250 ea
diam. 3.5 in.	diam. -	diam. -	diam. -
dish diam. 89 mm	dish diam. -	dish diam. -	dish diam. -

General description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. (provided by RefSeq)

Immunogen

CCND2 (NP_001750.1, 1 a.a. ~ 289 a.a) full-length human protein.

Sequence
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

09047

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

SOX2 controls tumour initiation and cancer stem-cell functions in squamous-cell carcinoma.

Soufiane Boumahdi et al.

Nature, 511(7508), 246-250 (2014-06-10)

Cancer stem cells (CSCs) have been reported in various cancers, including in skin squamous-cell carcinoma (SCC). The molecular mechanisms regulating tumour initiation and stemness are still poorly characterized. Here we find that Sox2, a transcription factor expressed in various types

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service