SAB1412432

ANTI-MUC2 antibody produced in mouse

clone 3A9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MLP, MUC2, SMUC
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3A9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.63 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable

Description

General description

Mucin 2, oligomeric mucus/gel-forming (MUC2) is encoded by the gene mapped within 400kb on human chromosome 11p15.5. The encoded protein has a molecular mass of ~550kDa and is expressed at high levels in the intestine and at lower levels in the respiratory tree. Mucin is a key component of mucus and it consists of one partial von Willebrand domain (vWD) at N- terminal and two complete domains including CysD domain and two proline, threonine and serine (PTS) domains that become densely O-glycosylated to form the prolonged mucin domains.

Immunogen

MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

Biochem/physiol Actions

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable