Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

SAB1412652

Sigma-Aldrich

ANTI-CA1 antibody produced in mouse

clone 10E4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

CA1, Car1

Sign Into View Organizational & Contract Pricing

Select a Size

All Photos(2)

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

10E4, monoclonal

form

buffered aqueous solution

mol wt

antigen 54.45 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

General description

Carbonic anhydrase 1 (CA1) is a cytosolic protein, encoded by the gene mapped to human chromosome 8q21.2. The encoded protein belongs to the carbonic anhydrase (CA) family. CA1 is highly expressed in blood. Its expression is also found in spinal cord motor neurons, intestinal, vascular, corneal epithelia, synovium and cardiac capillary endothelial cells.
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature. (provided by RefSeq)

Immunogen

CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Biochem/physiol Actions

Carbonic anhydrase 1 (CA1) catalyzes the reversible hydration and dehydration reactions of CO2/ carbonic acid (H2CO3). It plays a vital role in transport of metal ions. In addition, it might also be involved in biomineralization and new bone formation. CA1 acts as an oncogene and leads to irregular cell calcification, apoptosis and migration in breast tumor tissues. Overexpression of the gene has been observed in serum of stage I non-small cell lung cancer (NSCLC) patients. It can be used as a potential biomarker for early diagnosis of NSCLC. Additionally, CA1 is also upregulated in amyotrophic lateral sclerosis (ALS) and is involved in motor neuron degeneration.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
12174-S877
06314-10E4

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service