Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2101940

Sigma-Aldrich

Anti-RAD54L antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-HHR54, Anti-HR54, Anti-HRAD54, Anti-RAD54-like (S. cerevisiae), Anti-RAD54A

Sign Into View Organizational & Contract Pricing

Select a Size


Select a Size

Change View

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

mol wt

84 kDa

species reactivity

guinea pig, horse, dog, rat, human, bovine, rabbit

packaging

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

concentration

0.5 mg - 1 mg/mL

Immunogen

Synthetic peptide directed towards the N terminal region of human RAD54L

Biochem/physiol Actions

This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Gene expression profiles of non-small cell lung cancer: survival prediction and new biomarkers.
Valk K
Oncology, 79(3-4), 283-292 (2010)
Cross-Species Genomics Identifies TAF12, NFYC, and RAD54L as Choroid Plexus Carcinoma Oncogenes.
Tong Y
Cancer Cell, 27(5), 712-727 (2015)
Single nucleotide polymorphisms of RecQ1, RAD54L, and ATM genes are associated with reduced survival of pancreatic cancer.
Li D
Journal of Clinical Oncology, 24(11), 1720-1728 (2006)
Implications of a RAD54L polymorphism (2290C/T) in human meningiomas as a risk factor and/or a genetic marker.
Leone PE
BMC Cancer, 3:6, 1-8 (2003)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service