Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2104456

Sigma-Aldrich

Anti-PGM1 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

61 kDa

species reactivity

rabbit, mouse, guinea pig, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PGM1(5236)

General description

The gene PGM1 (phosphoglucomutase 1) is mapped to human chromosome 1p31. It belongs to the phosphohexose mutase family of proteins.

Immunogen

Synthetic peptide directed towards the middle region of human PGM1

Biochem/physiol Actions

PGM1 (phosphoglucomutase 1) plays a crucial role in glucose homeostasis and is responsible for regulating the switch between glycolysis and gluconeogenesis. It is mainly involved in the reversible conversion of glucose 1-phosphate and glucose 6-phosphate. It also participates in protein N-glycosylation. Deficiency of PGM1 has been associated with metabolic disorders, such as hepatopathy, dilated cardiomyopathy and exercise intolerance.

Sequence

Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Eunju Bae et al.
FEBS letters, 588(17), 3074-3080 (2014-06-22)
Phosphoglucomutase (PGM)1 catalyzes the reversible conversion reaction between glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P). Although both G-1-P and G-6-P are important intermediates for glucose and glycogen metabolism, the biological roles and regulatory mechanisms of PGM1 are largely unknown. In this study
Naheed A Rana et al.
Human molecular genetics, 13(24), 3089-3102 (2004-10-29)
The distribution of linkage disequilibrium (LD) in the human genome has important consequences for the design of experiments that infer susceptibility genes for complex disease using association studies. Recent studies have shown a non-random distribution of human meiotic recombination associated
Yingying Lee et al.
The Journal of biological chemistry, 289(46), 32010-32019 (2014-10-08)
Recent studies have identified phosphoglucomutase 1 (PGM1) deficiency as an inherited metabolic disorder in humans. Affected patients show multiple disease phenotypes, including dilated cardiomyopathy, exercise intolerance, and hepatopathy, reflecting the central role of the enzyme in glucose metabolism. We present

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service