WH0003569M1

Monoclonal Anti-IL6 antibody produced in mouse

clone 3E4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6, Anti-interleukin 6 (interferon, beta 2)
• MDL number: MFCD00162579
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ

Description

General description

Interleukin-6 (IL-6) is a proinflammatory cytokine. The gene encoding it has five exons and is located on human chromosome 7. Human IL-6 is a 21–26 kDa glycoprotein. It has 212 amino acids along with a 28-amino-acid-signal peptide.

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)

Immunogen

IL6 (NP_000591, 29 a.a. ~ 212 a.a) recombinant protein.

Sequence
SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Biochem/physiol Actions

Interleukin-6 (IL-6) plays a vital role in intracellular signaling pathways. The protein is linked with cancerous cell metastasis and growth. IL-6 serves as a modulator of estrogen synthesis and aromatase activity. IL-6 stimulates immunoglobulin synthesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)