WH0007360M1

Monoclonal Anti-UGP2 antibody produced in mouse

clone 3H3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-UDP-glucose pyrophosphorylase 2, Anti-UDPG, Anti-UDPGP2, Anti-UGPP2, Anti-pHC379
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3H3, monoclonal
• form: buffered aqueous solution
• species reactivity: human, rat, mouse
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_001001521
• UniProt accession no.: Q16851
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... UGP2(7360)

Description

General description

The UDP-glucose pyrophosphorylase 2 (UGP2 ) gene is localized on human chromosome 2p15. It has a crucial role in carbohydrate metabolism. Its product uridine diphosphate-glucose (UDP-glucose) acts as a precursor for sugar nucleotides and is involved in various pathways. The enzyme is involved in the conversion of glucose-1-phosphate and MgUTP to UDP-glucose and MgPPi.

Immunogen

UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI

Application

Monoclonal Anti-UGP2 antibody produced in mouse has been used in Western blotting.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)