WH0057804M1
Monoclonal Anti-POLD4 antibody produced in mouse
clone 2B11, ascites fluid
Synonym(s):
Anti-POLDS, Anti-p12, Anti-polymerase (DNA-directed), delta 4
Sign Into View Organizational & Contract Pricing
Select a Size
All Photos(2)
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
General description
DNA polymerase δ 4 (POLD4), also known as p12, is the smallest subunit of DNA polymerase (Pol) δ. It is encoded by the gene mapped to human chromosome 11q13.2.
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).
Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Biochem/physiol Actions
DNA polymerase (Pol) δ plays a vital role in DNA replication, DNA repair processes and genetic recombination. POLD4 stabilizes the Pol δ holoenzyme. In addition, it also facilitates pol δ-PCNA complex stabilization. Proteolysis of POLD4 in response to DNA damage leads to the consequent conversion of the holoenzyme pol δ4 to the heterotrimer pol δ3. Pol δ3 acts as an antimutator polymerase and is supposed to enhance surveillance against mutagenesis. Downregulated expression of the gene is associated with the genomic instability in lung cancer.
Physical form
Solution
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
nwg
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
PPP6R3?USP6 amplification: Novel oncogenic mechanism in malignant nodular fasciitis
Guo R, et al.
Genes Chromosomes Cancer, 640-9 null
A novel DNA damage response: rapid degradation of the p12 subunit of dna polymerase delta.
Zhang S, et al.
The Journal of Biological Chemistry, 15330-40 null
Proteolysis of the Human DNA Polymerase Delta Smallest Subunit p12 by μ-Calpain in Calcium-Triggered Apoptotic HeLa Cells
Fan X, et al.
PLoS ONE null
Regulation of DNA Polymerase POLD4 Influences Genomic Instability in Lung Cancer
Huang QM, et al.
Cancer Research, 8407-16 null
Sufang Zhang et al.
The Journal of biological chemistry, 282(21), 15330-15340 (2007-02-24)
Mammalian DNA polymerase (Pol) delta is essential for DNA replication. It consists of four subunits, p125, p50, p68, and p12. We report the discovery that the p12 subunit is rapidly degraded in cultured human cells by DNA damage or replication
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service