Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB1410940

Sigma-Aldrich

Anti-IL23A antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 20.7 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL23A(51561)

Description générale

Interleukin 23 subunit α (IL23A) gene with 4 exons, spanning 1531bp of genomic DNA, is mapped to human chromosome 12q13.2. The gene codes for a 19kDa cytokine, p19. The protein consists of a signal peptide and mature peptide composed of four α helices.
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the β1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-γ(IFNG). In contrast to IL12, which acts mainly on naive CD4+ T cells, IL23 preferentially acts on memory CD4+ T cells. (provided by RefSeq)

Immunogène

IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.

Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Actions biochimiques/physiologiques

Interleukin 23 subunit α (IL23A) plays a vital role downstream of the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway, that transduces signals for cell proliferation, differentiation, cell migration and apoptosis. Elevated expression of IL23A has been observed in meibomian cell carcinoma (MCC). Mutation in the gene increases the risk of susceptibility to psoriatic arthritis (PsA) as well as psoriasis.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique