Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SML3264

Sigma-Aldrich

Teduglutide trifluoroacetate

≥95% (HPLC)

Synonyme(s) :

ALX 0600, TFA salt, ALX-0600, TFA salt, ALX0600, TFA salt, HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, TFA salt, His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp, TFA salt, [Gly2]-GLP-2 (human), TFA salt, [Gly2]-Glucagon-like peptide II (human), TFA salt, [Gly2]GLP-2 (human), TFA salt

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352200
Nomenclature NACRES :
NA.77

Niveau de qualité

Essai

≥95% (HPLC)

Forme

powder

Conditions de stockage

desiccated

Couleur

white to off-white

Température de stockage

−20°C

Catégories apparentées

Actions biochimiques/physiologiques

Dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of short bowel syndrome (SBS).
Teduglutide is a dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of gastrointestinal diseases, including short bowel syndrome (SBS), by promoting crypt cell proliferation, villus height expansion, and nutrient absorption. Experimental models of intestinal injury suggest that GLP-2 signaling exerts protective effects by increasing mesenteric blood flow, reducing intestinal inflammation, and facilitating structural and functional adaptation following major small bowel resection.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

Si vous avez besoin d'assistance, veuillez contacter Service Clients

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique