Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Principaux documents

WH0023265M1

Sigma-Aldrich

Monoclonal Anti-EXOC7 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-253p, Anti-EX070, Anti-EXO70, Anti-EXOC1, Anti-Exo70p, Anti-YJL085W, Anti-exocyst complex component 7

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

rat, human, mouse

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EXOC7(23265)

Description générale

EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al., 2006 [PubMed 17086175]).[supplied by OMIM

Immunogène

EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA

Actions biochimiques/physiologiques

EXOC7 (Exocyst complex component 7) is mainly involved in the exocytosis, a membrane trafficking process of intracellular protein elements such as hormones and neurotransmitters, membrane proteins and lipids to specific domains of the plasma membrane. Exocytosis plays a vital role in the cellular growth, development and cell polarity establishment. During exocytosis, it directly connects with the plasma membrane through its direct interaction with phosphatidylinositol 4,5-bisphosphate (PI(4,5)P(2)). It has also been reported that the interaction between EXOC7 and PI(4,5)P(2) is highly essential for the docking and fusion of post-Golgi secretory vesicles.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique