AV46947

Anti-PILRA antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FDF03, Anti-Paired immunoglobin-like type 2 receptor α
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 18 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_840056
• UniProt 수납 번호: Q9UKJ1-4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... PILRA(29992)

설명

면역원

Synthetic peptide directed towards the N terminal region of human PILRA

애플리케이션

Anti-PILRA antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

생화학적/생리학적 작용

PILRA (Paired immunoglobin-like type 2 receptor alpha) gene encodes a single-pass type I membrane protein predominantily expressed in immune cells like monocytes, granulocytes and dendritic cells. PILR-associating neural protein (PANP) is a ligand for PILRA that facilitates the immune system regulation. It plays a pivotal role in regulating cell signaling via SHP-1 by balancing the PILRalpha-mediated inhibition and PILRbeta-mediated activation. Additionally, PILRalpha facilitates as a coreceptor that acquaints with glycoprotein B (gB) and assists in herpes simplex virus-1 entry. Further, it regulates the membrane fusion of the viral envelope with cellular membranes during virus entry and virus-induced cell-to-cell fusion.

서열

Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable