I17001

Interferon-γ human

IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested

• 동의어(들): IFN-γ
• MDL number: MFCD00131391
• UNSPSC 코드: 12352202
• NACRES: NA.77

속성

• 재조합: expressed in HEK 293 cells
• Quality Level: 200
• 분석: ≥98% (SDS-PAGE)
• 양식: lyophilized powder
• 효능: ≤0.250 ng/mL In Viral Resistance Assay ED₅₀
• 분자량: 16 kDa (glycosylated)
• 기술: cell culture | mammalian: suitable
• 적합성: endotoxin tested
• 저장 온도: −20°C

설명

일반 설명

Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.

Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.

애플리케이션

Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.

It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.

생화학적/생리학적 작용

IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.

서열

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

분석 메모

The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable