SAB2104260

Anti-EBF2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-COE2, Anti-EBF-2, Anti-FLJ11500, Anti-O/E-3, Anti-OE-3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 63 kDa
• 종 반응성: bovine, horse, human, rabbit, mouse, rat, guinea pig, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_022659
• UniProt 수납 번호: Q9HAK2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EBF2(64641)

설명

면역원

Synthetic peptide directed towards the middle region of human EBF2

생화학적/생리학적 작용

EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-103 AU120738.1 302-404 104-650 AL701879.1 1-547 651-735 AC090103.4 79460-79544 736-796 BC069665.1 1-61 797-1794 BC074794.2 1-998 1795-2297 AK021562.1 1082-1584

서열

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable