SAB2104467

Anti-ETV1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-DKFZp781L0674, Anti-ER81, Anti-MGC104699, Anti-MGC120533, Anti-MGC120534
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 55 kDa
• 종 반응성: dog, horse, mouse, guinea pig, human, rat, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NM_004956
• UniProt 수납 번호: P50549
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ETV1(2115)

설명

일반 설명

Ets variant gene 1 (ETV1) is a novel androgen-regulated gene mapped to human chromosome 7p21.2. ETV1 protein belongs to the E-twenty-six (ETS) transcription factor family and it contains the ETS domain and acidic transactivation domain. ETV1 binds to DNA sequences containing the consensus pentanucleotide 5′-CGGA[AT]-3′.

면역원

Synthetic peptide directed towards the middle region of human ETV1

애플리케이션

Anti-ETV1 antibody produced in rabbit has been used in western blot(1:500)

생화학적/생리학적 작용

E-twenty-six (ETS) proteins participate in cell proliferation and cancer cell invasion. Ets variant gene 1 (ETV1) acts as a neuregulin-1 (NRG1) responsive factor and is important for establishing rapid conduction physiology in the heart. Overexpression of the gene has been observed in various types of cancers including prostate cancer and gastrointestinal stromal tumors

서열

Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable