WH0000246M4

Monoclonal Anti-ALOX15 antibody produced in mouse

clone 3D8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-arachidonate 15-lipoxygenase
• MDL number: MFCD08064406
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3D8, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC029032
• UniProt 수납 번호: P16050
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ALOX15(246)

설명

일반 설명

The gene arachidonate 15-lipoxygenase (ALOX15) is mapped to human chromosome 17p13. It is mainly present in the epithelial cells in the upper airways, reticulocytes, eosinophils and macrophages. ALOX15 belongs to the dioxygenases family. It is an IL-4 (interleukin 4)/IL-13 target gene.

면역원

ALOX15 (AAH29032, 1 a.a. ~ 662 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

생화학적/생리학적 작용

ALOX15 (arachidonate 15-lipoxygenase) is involved in homeostatic as well as pathological responses. ALOX15 is responsible for the oxidation of unsaturated fatty acids (at the 15 position) to active hydroperoxy and epoxy metabolites. It is also responsible for the conversion of linoleic acid to anti-tumor 13-S-hydroxyoctadecadienoic acid. ALOX15 is required for IL-4 (interleukin-4)/IL-13-mediated macrophage polarization. In mice, it is a negative regulator of bone mineral density. It is also involved in fatty acid metabolism. It controls MAPK (mitogen activated protein kinase) signaling in human airway epithelial cells using phosphatidylethanolamine-binding protein.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)