Skip to Content
Merck
All Photos(2)

Key Documents

SAB1411910

Sigma-Aldrich

ANTI-PPARGC1A antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B5, monoclonal

form

buffered aqueous solution

mol wt

antigen 37.84 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PPARGC1A(10891)

General description

PPARG (peroxisome proliferator activated receptor gamma) coactivator 1 α (PPARGC1A) is a 91kDa multifunctional regulatory factor, encoded by the gene mapped to human chromosome 4p15.1. The encoded protein is mainly expressed in heart, skeletal muscle and kidney.
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)

Immunogen

PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Biochem/physiol Actions

PPARG coactivator 1 α (PPARGC1A) interacts with a wide range of transcription factors and plays a vital role in cellular energy metabolism. The encoded protein regulates activity of many transcription factors and functions as a molecular switch for various cellular processes, such as mitochondrial biogenesis and respiration, gluconeogenesis and glucose transport, glycogenolysis, fatty acid oxidation, peroxisomal remodeling, muscle fiber-type switching and oxidative phosphorylation. Additionally, it is also acts as a regulator of Type 2 diabetes mellitus (T2DM) and is considered to be a potential target for anti-diabetic therapy. The protein functions as a tumor suppressor in hepatocellular carcinoma and can be used as a promising therapeutic target for the same. It is downregulated in prostate cancer. Presence of PPARGC1A inhibits prostate cancer progression and metastasis. However, presence of this protein gives selective advantages in breast cancer and melanoma cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service