SAB1411910
ANTI-PPARGC1A antibody produced in mouse
clone 3B5, purified immunoglobulin, buffered aqueous solution
Synonym(s):
LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A
About This Item
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3B5, monoclonal
form
buffered aqueous solution
mol wt
antigen 37.84 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
1 of 4
This Item | SAB1411922 | WH0010891M3 | SAB2108742 |
---|---|---|---|
biological source mouse | biological source mouse | biological source mouse | biological source rabbit |
clone 3B5, monoclonal | clone 2F9, monoclonal | clone 1F3, monoclonal | clone polyclonal |
antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form purified immunoglobulin | antibody form affinity isolated antibody |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
species reactivity human | species reactivity human | species reactivity human | species reactivity dog, human, guinea pig, rat |
Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1A(10891) | Gene Information human ... PPARGC1A(10891) |
General description
Immunogen
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Biochem/physiol Actions
Physical form
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service